PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G176900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 333aa    MW: 37525.8 Da    PI: 4.8948
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G176900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.8e-092642962355
                          SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  Manes.09G176900.1.p 264 PYPTEEEKVKLSEITGLDQKQINNWFINQRKRH 296
                          8*****************************885 PP

2ELK36.79.2e-13216237122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          +LK +LlrKYsgyL+sL++EF+
  Manes.09G176900.1.p 216 DLKGMLLRKYSGYLSSLRKEFL 237
                          69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-1971115IPR005540KNOX1
PfamPF037904.2E-2073112IPR005540KNOX1
SMARTSM012564.2E-27119170IPR005541KNOX2
PfamPF037916.1E-25122169IPR005541KNOX2
PfamPF037899.5E-10216237IPR005539ELK domain
SMARTSM011881.1E-6216237IPR005539ELK domain
PROSITE profilePS5121310.842216236IPR005539ELK domain
PROSITE profilePS5007111.677236299IPR001356Homeobox domain
SMARTSM003893.7E-12238303IPR001356Homeobox domain
SuperFamilySSF466895.56E-19239310IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-27241301IPR009057Homeodomain-like
CDDcd000866.68E-12248300No hitNo description
PfamPF059205.6E-17256295IPR008422Homeobox KN domain
PROSITE patternPS000270274297IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEDLYRLDPT ISCSENIVTV QNFPARNLFT ASSSSSTATT TATHEFYTSV GNLLQFQAAG  60
HAQDFESNMV HLIKTQIANH PRYPDLVSAY IECQKVGAPP EMASLLEEIS REKYSIKSCS  120
SQIGADPELD EFMESYCELL YRYKEELSRP FDEATTFLSN IESQLSNLCK GTLTKTFDYY  180
GSDEAAGTSE EELSCGEVEA SESQESSGAG RGRDQDLKGM LLRKYSGYLS SLRKEFLKTK  240
KKGKLPKDAR MILLDWWSNH YRWPYPTEEE KVKLSEITGL DQKQINNWFI NQRKRHWKPS  300
EDMRFALMEG VSSSSSLGGH SFFDNGGGGR ED*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012089429.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-101KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLB9RFJ21e-178B9RFJ2_RICCO; Homeobox protein knotted-1, putative
STRINGPOPTR_0013s01000.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-80KNOTTED1-like homeobox gene 6